PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa012255
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family Dof
Protein Properties Length: 356aa    MW: 38682.8 Da    PI: 7.4998
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58684311PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.86.4e-403899263
     zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63
               +e+alkcprCds ntkfCyynnysl+qPryfCk+CrryWtkGG+lrnvPvGgg+rknk+sss
  Lsa012255 38 PEDALKCPRCDSGNTKFCYYNNYSLTQPRYFCKSCRRYWTKGGTLRNVPVGGGCRKNKRSSS 99
               57899*****************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-322796IPR003851Zinc finger, Dof-type
PfamPF027012.1E-334096IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.3944296IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104480IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MDVSGVHHHY QQQEMSSHML DSMLVCTKAQ QDKKPKPPED ALKCPRCDSG NTKFCYYNNY  60
SLTQPRYFCK SCRRYWTKGG TLRNVPVGGG CRKNKRSSSS SSSATSPISS SASALSKIRG  120
PQDHHLNIQQ HHQHPLNIIT SSNSNNHLLS SGLGHLPYDS TDLSLAFARL QGQANTHLGF  180
DQFDQNDPTS NHNLGFLDAI RGGFLENMHT SNGFHNVLYS GGNLGNGEMG SVGNLIMGLN  240
NGTRNHDQDQ EIMNPMFHDH QQHMMNNGST CSATTAVTMT TVKQEACNMM KSSEFGESRP  300
GGGGGGVLWG FPWQIGGGGG DQGNMAHDVE SGRSQIGGWN GISSTAWHGL IDSPLM
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009622795.11e-90PREDICTED: dof zinc finger protein DOF2.1-like
RefseqXP_016492247.11e-90PREDICTED: dof zinc finger protein DOF2.1-like
TrEMBLA0A124SGZ11e-147A0A124SGZ1_CYNCS; Zinc finger, Dof-type
STRINGSolyc06g075370.2.15e-82(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.11e-39TARGET OF MONOPTEROS 6